ELISA Recombinant Staphylococcus aureus Clumping factor A(clfA) ,partial

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Microbiology Target / Protein: clfA Biologically active: Not Tested Expression system: E.coli Species of origin: Staphylococcus aureus (strain COL) Delivery time: 3-7 business days Uniprot ID: Q5HHM8 AA Sequence: GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 229-559aa Protein length: Partial MW: 52 kDa Alternative Name(s): Fibrinogen receptor A Fibrinogen-binding protein A Relevance: Cell surface-associated protein implicated in virµLence. Promotes bacterial attachment exclusively to the gamma-chain of fibrinogen. Induces formation of bacterial clumps (By similarity) Reference: "Insights on evolution of virµLence and resistance from the complete genome analysis of an early methicillin-resistant Staphylococcus aureus strain and a biofilm-producing methicillin-resistant Staphylococcus epidermidis strain."Gill S.R., Fouts D.E., Archer G.L., Mongodin E.F., DeBoy R.T., Ravel J., PaµLsen I.T., Kolonay J.F., Brinkac L.M., Beanan M.J., Dodson R.J., Daµgherty S.C., Madupu R., Angiuoli S.V., Durkin A.S., Haft D.H., Vamathevan J.J., Khouri H. Fraser C.M.J. Bacteriol. 187:2426-2438(2005) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.