ELISA Recombinant Tuber borchii Cyanovirin-N homolog

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q5MK11 Gene Names: N/A Organism: Tuber borchii (White truffle) AA Sequence: MSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDTCIGNPNGFLGWGMQNFSHSSEDIKLEEGGRKLTCRPKTVDGGFRERQGIDLNRIQNVNGRLVFQ Expression Region: 1-103aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 15.4 kDa Alternative Name(s): Relevance: Mannose-binding lectin. Reference: "Gene expression profiling of the nitrogen starvation stress response in the mycorrhizal ascomycete Tuber borchii." Montanini B., Gabella S., Abba S., Peter M., Kohler A., Bonfante P., Chalot M., Martin F., Ottonello S. Fungal Genet. Biol. 43:630-641(2006) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.