ELISA Recombinant Rickettsia japonica 17 kDa surface antigen(omp)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Microbiology Target / Protein: omp Biologically active: Not Tested Expression system: E.coli Species of origin: Rickettsia japonica (strain ATCC VR-1363 / YH) Delivery time: 3-7 business days Uniprot ID: Q52764 AA Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 20-159aa Protein length: FµLl Length MW: 30.5 kDa Alternative Name(s): Relevance: Reference: "Specific amplification of Rickettsia japonica DNA from clinical specimens by PCR."Furuya Y., Katayama T., Yoshida Y., Kaiho I.J. Clin. Microbiol. 33:487-489(1995) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.