ELISA Recombinant Rickettsia japonica 17KDA surface antigen(omp)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Microbiology Uniprot ID: Q52764 Gene Names: omp Organism: Rickettsia japonica (strain ATCC VR-1363 / YH) AA Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN Expression Region: 20-159aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 30.5 kDa Alternative Name(s): Relevance: Reference: "Specific amplification of Rickettsia japonica DNA from clinical specimens by PCR."Furuya Y., Katayama T., Yoshida Y., Kaiho I.J. Clin. Microbiol. 33:487-489(1995) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.