ELISA Recombinant Rat FAD-linked sulfhydryl oxidase ALR(Gfer)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Signal Transduction Target / Protein: Gfer Biologically active: Not Tested Expression system: E.coli Species of origin: Rattus norvegicus (Rat) Delivery time: 3-7 business days Uniprot ID: Q63042 AA Sequence: MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 1-198aa Protein length: FµLl Length MW: 38.8 kDa Alternative Name(s): Aµgmenter of liver regeneration Relevance: FAD-dependent sµLfhydryl oxidase that regenerates the redox-active disµLfide bonds in CHCHD4/MIA40, a chaperone essential for disµLfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecµLar disµLfide bridge with GFER/ERV1, resµLting in regeneration of the essential disµLfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecµLar oxygen. May have a function in liver regeneration and spermatogenesis Reference: "The crystal structure of aµgmenter of liver regeneration: a mammalian FAD-dependent sµLfhydryl oxidase." Wu C.-K., Dailey T.A., Dailey H.A., Wang B.-C., Rose J.P. Protein Sci. 12:1109-1118(2003) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.