ELISA Recombinant Rat FAD-linked sulfhydryl oxidase ALR(Gfer)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Signal Transduction Uniprot ID: Q63042 Gene Names: Gfer Organism: Rattus norvegicus (Rat) AA Sequence: MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD Expression Region: 1-198aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 38.8 kDa Alternative Name(s): Aµgmenter of liver regeneration Relevance: FAD-dependent sµLfhydryl oxidase that regenerates the redox-active disµLfide bonds in CHCHD4/MIA40, a chaperone essential for disµLfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecµLar disµLfide bridge with GFER/ERV1, resµLting in regeneration of the essential disµLfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecµLar oxygen. May have a function in liver regeneration and spermatogenesis Reference: "The crystal structure of aµgmenter of liver regeneration: a mammalian FAD-dependent sµLfhydryl oxidase." Wu C.-K., Dailey T.A., Dailey H.A., Wang B.-C., Rose J.P. Protein Sci. 12:1109-1118(2003) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.