ELISA Recombinant Staphylococcus aureus Clumping factor A（clfA）

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Microbiology Target / Protein: clfA Biologically active: Not Tested Expression system: E.coli Species of origin: Staphylococcus aureus (strain MSSA476) Delivery time: 3-7 business days Uniprot ID: Q6GB45 AA Sequence: GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE Tag info: NO-tagged Expression Region: 228-558aa Protein length: Partial MW: 36.1 kDa Alternative Name(s): Fibrinogen receptor A Fibrinogen-binding protein A Relevance: Cell surface-associated protein implicated in virµLence. Promotes bacterial attachment exclusively to the gamma-chain of fibrinogen. Induces formation of bacterial clumps Reference: "Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virµLence and drµg resistance." Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J., Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A., Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C., Clark L., Corton C. Parkhill J. Proc. Natl. Acad. Sci. U.S.A. 101:9786-9791(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.