ELISA Recombinant Staphylococcus aureus Clumping factor A（clfA),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Microbiology Uniprot ID: Q6GB45 Gene Names: clfA Organism: Staphylococcus aureus (strain MSSA476) AA Sequence: GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE Expression Region: 228-558aa Sequence Info: Partial Source: E.coli Tag Info: NO-tagged MW: 36.1 kDa Alternative Name(s): Fibrinogen receptor A Fibrinogen-binding protein A Relevance: Cell surface-associated protein implicated in virµLence. Promotes bacterial attachment exclusively to the gamma-chain of fibrinogen. Induces formation of bacterial clumps Reference: "Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virµLence and drµg resistance." Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J., Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A., Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C., Clark L., Corton C. Parkhill J. Proc. Natl. Acad. Sci. U.S.A. 101:9786-9791(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.