ELISA Recombinant Vesicular stomatitis Indiana virus Protein C'(P)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171228 Research areas: Others Target / Protein: p Biologically active: Not Tested Expression system: E.coli Species of origin: VesicµLar stomatitis Indiana virus (strain Mudd-Summers) (VSIV) Delivery time: 3-7 business days Uniprot ID: Q86132 AA Sequence: MRSKHNELKSPIMSCSKRTEWKSILGPLIFRQQMILTQNLNQKLKTIKACMYQIRKLSKLKALYRGL Tag info: N-terminal 6xHis-tagged Expression Region: 1-67aa Protein length: FµLl Length MW: 11.9 kDa Alternative Name(s): Relevance: May play a role in viral pathogenesis or transmission by insects vectors. Reference: "Cloning and expression of a viral phosphoprotein: structure sµggests vesicµLar stomatitis virus NS may function by mimicking an RNA template." Hudson L.D., Condra C., Lazzarini R.A. J. Gen. Virol. 67:1571-1579(1986) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.