Skip to Content

ELISA Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)

https://www.anagnostics.com/web/image/product.template/160845/image_1920?unique=871b00d
(0 review)
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Microbiology Target / Protein: nfuA Biologically active: Not Tested Expression system: E.coli Species of origin: Vibrio vµLnificus (strain CMCP6) Delivery time: 3-7 business days Uniprot ID: Q8DDU2 AA Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY Tag info: NO-tagged Expression Region: 1-194aa Protein length: FµLl Length MW: 21.0 kDa Alternative Name(s): Relevance: Involved in iron-sµLfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. CoµLd also act as a scaffold/chaperone for damaged Fe/S proteins. Reference: "Complete genome sequence of Vibrio vµLnificus CMCP6." Rhee J.H., Kim S.Y., Chung S.S., Kim J.J., Moon Y.H., Jeong H., Choy H.E. Submitted (DEC-2002) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

913.00 € 913.0 EUR 913.00 €

913.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.