ELISA Recombinant Theragra chalcogramma Parvalbumin beta-1

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q90YK8 Gene Names: N/A Organism: Theragra chalcogramma (Alaska pollock) (Gadus chalcogrammus) AA Sequence: SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA Expression Region: 2-109aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged MW: 31.4 kDa Alternative Name(s): Allergen: The c 1 Relevance: In muscle, parvalbumin is thoµght to be involved in relaxation after contraction. It binds two calcium ions (By similarity). Reference: "Characterization of parvalbumin, the major allergen in Alaska pollack, and comparison with codfish Allergen M."Van Do T., Hordvik I., Endresen C., Elsayed S.Mol. Immunol. 42:345-353(2005) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.