ELISA Recombinant Rat Sclerostin(Sost)
Quantity:100µg. Other Quantitys are also available. For further information, please contact us.
Research Areas:Stem Cells
Uniprot ID:Q99P67
Gene Names:Sost
Organism:Rattus norvegicus (Rat)
AA Sequence:FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY
Expression Region:29-213aa
Sequence Info:FµLl Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:28.0 kDa
Alternative Name(s):Sost; Sclerostin
Relevance:Negative regµLator of bone growth that acts throµgh inhibition of Wnt signaling and bone formation.
Reference:"Noggin and sclerostin bone morphogenetic protein antagonists form a mutually inhibitory complex." Winkler D.G., Yu C., Geoghegan J.C., Ojala E.W., Skonier J.E., Shpektor D., Sutherland M.K., Latham J.A. J. Biol. Chem. 279:36293-36298(2004)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Negative regµLator of bone growth that acts throµgh inhibition of Wnt signaling and bone formation.
Involvement in disease:
SubcellµLar Location:Secreted
Protein Families:Sclerostin family
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Rn&CID=95369
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?rno:80722
STRING Database Link:https://string-db.org/network/10116.ENSRNOP00000028238
OMIM Database Link:
Lead Time Guidance:3-7 business days
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.