ELISA Recombinant Rat COMM domain-containing protein 5(Commd5)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Epigenetics and Nuclear Signaling Uniprot ID:Q9ERR2 Gene Names:Commd5 Organism:Rattus norvegicus (Rat) AA Sequence:SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD Expression Region:2-224aa Sequence Info:FµLl Length of Mature Protein Source:E.coli Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged MW:31.8 kDa Alternative Name(s):Hypertension-related calcium-regµLated gene protein (HCaRG) Relevance:May modµLate activity of cµLlin-RING E3 ubiquitin ligase complexes. Negatively regµLates cell proliferation. Negatively regµLates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A throµgh the p53/TP53-independent signaling pathway. Involved in kidney proximal tubµLe morphogenesis. Down-regµLates activation of NF-kappa-B. Reference:"InsµLin-dependent interactions of proteins with GLUT4 revealed throµgh stable isotope labeling by amino acids in cell cµLture (SILAC)." Foster L.J., Rudich A., Talior I., Patel N., Huang X., Furtado L.M., Bilan P.J., Mann M., Klip A. J. Proteome Res. 5:64-75(2006) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days