ELISA Recombinant Staphylococcus epidermidis mRNA interferase MazF(mazF)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Others Uniprot ID:Q9F7V5 Gene Names:mazF Organism:Staphylococcus epidermidis AA Sequence:MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITDGINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS Expression Region:1-120aa Sequence Info:FµLl Length Source:E.coli Tag Info:N-terminal 6xHis-tagged MW:19.0 kDa Alternative Name(s):Toxin MazF (mRNA interferase MazF) Relevance:Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5'-UACAU-3' in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE. Reference:"Biofilm formation by Staphylococcus epidermidis depends on functional rsbU, an activator of the sigB operon: differential activation mechanisms due to ethanol and salt stress." Knobloch J.K.-M., Bartscht K., Sabottke A., Rohde H., Feucht H.-H., Mack D. J. Bacteriol. 183:2624-2633(2001) Purity:Greater than 90% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5'-UACAU-3' in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE. Involvement in disease: SubcellµLar Location: Protein Families:PemK/MazF family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days