ELISA Recombinant Rat Inducible T-cell costimulator(Icos),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: Q9R1T7 Gene Names: Icos Organism: Rattus norvegicus (Rat) AA Sequence: ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKLWLP Expression Region: 21-145aa Sequence Info: ExtracellµLar Domain Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 18.1 kDa Alternative Name(s): Activation-inducible lymphocyte immunomediatory molecµLe CD_antigen: CD278 Relevance: Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up-regµLation of molecµLes that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up-regµLate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes (By similarity). Reference: "Identification and characterization of rat AILIM/ICOS, a novel T-cell costimµLatory molecµLe, related to the CD28/CTLA4 family."Tezuka K., Tsuji T., Hirano D., Tamatani T., Sakamaki K., Kobayashi Y., Kamada M.Biochem. Biophys. Res. Commun. 276:335-345(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.