ELISA Recombinant Salmonella enterica OmpA family protein(A673_03341),partial

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 20µg Updated Date: Stock Protein updated on 20170405 Research areas: Others Target / Protein: A673_03341 Biologically active: Not Tested Expression system: Mammalian cell Species of origin: Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958 Delivery time: 3-7 business days Uniprot ID: S4JJH7 AA Sequence: DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged Expression Region: 82-220aa Protein length: Partial MW: 18.6 kDa Alternative Name(s): Relevance: Reference: McClelland M., Porwollik S., Desai P., Cheng P., Wollam A., Pepin K., Palsikar V.B., FµLton L., FµLton R., Delehaunty K., Fronick C., Godfrey J., Waligorski J., Appelbaum E., TomLinson C., Warren W., Sodergren E., Weinstock G., Wilson R.K.Submitted (APR-2013) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.