ELISA Recombinant Salmonella enterica OmpA family protein(A673_03341),partial

Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: S4JJH7 Gene Names: A673_03341 Organism: Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958 AA Sequence: DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ Expression Region: 82-220aa Sequence Info: Partial Source: Mammalian cell Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 18.6 kDa Alternative Name(s): Relevance: Reference: McClelland M., Porwollik S., Desai P., Cheng P., Wollam A., Pepin K., Palsikar V.B., FµLton L., FµLton R., Delehaunty K., Fronick C., Godfrey J., Waligorski J., Appelbaum E., TomLinson C., Warren W., Sodergren E., Weinstock G., Wilson R.K.Submitted (APR-2013) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.