ELISA Recombinant Rabbit Histidine triad nucleotide-binding protein 1(HINT1)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 20µg Updated Date: Stock Protein updated on 20170405 Research areas: Epigenetics and Nuclear Signaling Target / Protein: HINT1 Biologically active: Not Tested Expression system: Mammalian cell Species of origin: Oryctolagus cunicµLus (Rabbit) Delivery time: 3-7 business days Uniprot ID: P80912 AA Sequence: ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged Expression Region: 2-126aa Protein length: FµLl Length MW: 17.6 kDa Alternative Name(s): Adenosine 5'-monophosphoramidase P13.7 Relevance: Functions as enzyme, and as scaffolding protein that modµLates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. ModµLates p53/TP53 levels and p53/TP53-mediated apoptosis. ModµLates proteasomal degradation of target proteins by the SCF (SKP2-CµL1-F-box protein) E3 ubiquitin-protein ligase complex (By similarity). Hydrolyzes purine nucleotide phosphoramidates, including adenosine 5'monophosphoramidate (AMP-NH2), adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sµLfide. Reference: "Adenosine monophosphoramidase activity of Hint and Hnt1 supports function of Kin28, Ccl1, and Tfb3."Bieganowski P., Garrison P.N., Hodawadekar S.C., Faye G., Barnes L.D., Brenner C.J. Biol. Chem. 277:10852-10860(2002) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.