ELISA Recombinant Vaejovis mexicanus smithi Potassium channel toxin alpha-KTx 21.1

Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 15-25 working days Research Topic: Others Uniprot ID: P0DJ31 Gene Names: N/A Organism: Vaejovis mexicanus smithi (Scorpion) (Vaejovis smithi) AA Sequence: AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC Expression Region: 1-36aa Sequence Info: FµLl Length Source: Mammalian cell Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 7.9 kDa Alternative Name(s): Toxin Vm24 Toxin alpha-KTx 21.1 Relevance: Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 µg) produce no symptoms of intoxication when injected into mice. Reference: "Structure, function, and chemical synthesis of vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of T lymphocytes." Gurrola G.B., Hernandez-Lopez R.A., Rodriguez de la Vega R.C., Varga Z., Batista C.V.F., Salas-Castillo S.P., Panyi G., del Rio-Portilla F., Possani L.D. Biochemistry 51:4049-4061(2012) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.