ELISA Recombinant C-X-C motif chemokine 5(CXCL5),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: P42830 Gene Names: CXCL5 Organism: Homo sapiens () AA Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG Expression Region: 37-110aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal GST-tagged MW: 34.9 kDa Alternative Name(s): ENA-78(1-78)Epithelial-derived neutrophil-activating protein 78Neutrophil-activating peptide ENA-78Small-inducible cytokine B5 Relevance: Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chotactic activity for neutrophil granµLocytes. Reference: Isolation of the CXC chemokines ENA-78, GRO alpha and GRO gamma from tumor cells and leukocytes reveals NH2-terminal heterogeneity. Functional comparison of different natural isoforms.Wuyts A., Govaerts C., Struyf S., Lenaerts J.-P., Put W., Conings R., Proost P., Van Damme J.Eur. J. Biochem. 260:421-429(1999) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.