ELISA Recombinant Rat Insulin-like growth factor I(Igf1)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P08025
Gene Names: Igf1
Organism: Rattus norvegicus (Rat)
AA Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
Expression Region: 49-118
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 34.7 kDa
Alternative Name(s): Somatomedin
Relevance: The insµLin-like growth factors, isolated from plasma, are structurally and functionally related to insµLin but have a much higher growth-promoting activity. May be a physiological regµLator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. StimµLates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insµLin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation
Reference: Primary structure of rat insµLin-like growth factor-I and its biological activities.Tamura K., Kobayashi M., Ishii Y., Tamura T., Hashimoto K., Nakamura S., Niwa M., Zapf J.J. Biol. Chem. 264:5616-5621(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.