ELISA Recombinant Rat Insulin-like growth factor I(Igf1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: P08025 Gene Names: Igf1 Organism: Rattus norvegicus (Rat) AA Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA Expression Region: 49-118 Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 34.7 kDa Alternative Name(s): Somatomedin Relevance: The insµLin-like growth factors, isolated from plasma, are structurally and functionally related to insµLin but have a much higher growth-promoting activity. May be a physiological regµLator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. StimµLates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insµLin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation Reference: Primary structure of rat insµLin-like growth factor-I and its biological activities.Tamura K., Kobayashi M., Ishii Y., Tamura T., Hashimoto K., Nakamura S., Niwa M., Zapf J.J. Biol. Chem. 264:5616-5621(1989) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.