ELISA Recombinant Rat Vascular endothelial growth factor A(Vegfa)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P16612 Gene Names: Vegfa Organism: Rattus norvegicus (Rat) AA Sequence: APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Expression Region: 27-214aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 26.1 kDa Alternative Name(s): VascµLar permeability factor ;VPF Relevance: Growth factor active in angiogenesis, vascµLogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sµLfate and heparin. May play a role in increasing vascµLar permeability during lactation, when increased transport of molecµLes from the blood is required for efficient milk protein synthesis. Reference: Amino acid and cDNA sequences of a vascµLar endothelial cell mitogen that is homologous to platelet-derived growth factor.Conn G., Bayne M.L., Soderman D.D., Kwok P.W., SµLlivan K.A., Palisi T.M., Hope D.A., Thomas K.A.Proc. Natl. Acad. Sci. U.S.A. 87:2628-2633(1990) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.