ELISA Recombinant Rat Natriuretic peptides B(NPPB),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P13205 Gene Names: NPPB Organism: Rattus norvegicus (Rat) AA Sequence: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF Expression Region: 77-121aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal GST-tagged MW: 32 kDa Alternative Name(s): Gamma-brain natriuretic peptideIso-ANP Relevance: Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascµLar homeostasis throµgh natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimµLates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3 Reference: Cloning and sequence analysis of cDNA encoding a precursor for rat brain natriuretic peptide.Kojima M., Minamino N., Kangawa K., Matsuo H.Biochem. Biophys. Res. Commun. 159:1420-1426(1989) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.