ELISA Recombinant Toxoplasma gondii Profilin(PRF)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q58NA1 Gene Names: PRF Organism: Toxoplasma gondii AA Sequence: SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY Expression Region: 2-163aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 21.4 kDa Alternative Name(s): Relevance: Reference: Structure-based analysis of Toxoplasma gondii profilin a parasite-specific motif is required for recognition by Toll-like receptor 11.Kucera K., Koblansky A.A., Saunders L.P., Frederick K.B., De La Cruz E.M., Ghosh S., Modis Y.J. Mol. Biol. 403:616-629(2010) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.