ELISA Recombinant Rat GTPase HRas(Hras)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P20171 Gene Names: Hras Organism: Rattus norvegicus (Rat) AA Sequence: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC Expression Region: 2-186aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 24.9 kDa Alternative Name(s): H-Ras-1Transforming protein p21c-H-rasp21ras Relevance: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Reference: RGS14 is a mµLtifunctional scaffold that integrates G protein and Ras/Raf MAPkinase signalling pathways.Shu F.J., Ramineni S., Hepler J.R.Cell. Signal. 22:366-376(2010) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.