ELISA Recombinant Rat Vasopressin V1a receptor(Avpr1a),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P30560
Gene Names: Avpr1a
Organism: Rattus norvegicus (Rat)
AA Sequence: SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK
Expression Region: 7-52aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 31.9 kDa
Alternative Name(s): AVPR V1aAntidiuretic hormone receptor 1aVascµLar/hepatic-type arginine vasopressin receptor
Relevance: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. Involved in social mory formation.
Reference: Immunocytochemical localization of vasopressin v1a receptors in the rat pituitary gonadotropes.Orcel H., Tobin V.A., Alonso G., Rabie A.Endocrinology 143:4385-4388(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.