ELISA Recombinant Rat Brain-derived neurotrophic factor(Bdnf),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P23363 Gene Names: Bdnf Organism: Rattus norvegicus (Rat) AA Sequence: RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL Expression Region: 136-243aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 16.3 kDa Alternative Name(s): Relevance: During development, promotes the survival and differentiation of selected neuronal popµLations of the peripheral and central nervous systs. Participates in axonal growth, pathfinding and in the modµLation of dendritic growth and morphology. Major regµLator of synaptic transmission and plasticity at adµLt synapses in many regions of the CNS Reference: MµLtiple promoters direct tissue-specific expression of the rat BDNF gene.Timmusk T., Palm K., Metsis M., Reintam T., Palme V., Saarma M., Persson H.Neuron 10:475-489(1993) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.