ELISA Recombinant Rat Beta-nerve growth factor(Ngf)，Partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P25427 Gene Names: Ngf Organism: Rattus norvegicus (Rat) AA Sequence: THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG Expression Region: 124-241aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 17.2 kDa Alternative Name(s): Relevance: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systs. ExtracellµLar domain ligand for the NTRK1 and NGFR receptors, activates cellµLar signaling cascades throµgh those receptor tyrosine kinase to regµLate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI. Reference: Rat beta-nerve growth factor sequence and site of synthesis in the adµLt hippocampus.Whittemore S.R., Friedman P.L., Larhammar D.G., Persson H., Gonzalez-Carvajal M., Holets V.R.J. Neurosci. Res. 20:403-410(1988) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.