ELISA Recombinant Rat Interleukin-18(Il18)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P97636 Gene Names: Il18 Organism: Rattus norvegicus (Rat) AA Sequence: HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS Expression Region: 37-194aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 22.3 kDa Alternative Name(s): Interferon gamma-inducing factor ;IFN-gamma-inducing factorInterleukin-1 gamma ;IL-1 gamma Relevance: Aµgments natural killer cell activity in spleen cells and stimµLates interferon gamma production in T-helper type I cells. Reference: Cloning of the cDNA for interleukin-18 in PC12 and expression in Escherichia coli.Kim S.-J., Kim C.-S., Song K.-Y., Kim J.-S., Jung K.-S. IL-18 translational inhibition restricts IFN-gamma expression in crescentic glomerµLonephritis.Garcia G.E., Xia Y., Ku G., Johnson R.J., Wilson C.B., Feng L.Kidney Int. 64:160-169(2003) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.