ELISA Recombinant Streptomyces avidinii Streptavidin

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P22629 Gene Names: N/A Organism: Streptomyces avidinii AA Sequence: DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ Expression Region: 25-183aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 43.5 kDa Alternative Name(s): Relevance: The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecµLe of biotin per subunit of streptavidin). Reference: Structural studies of binding site tryptophan mutants in the high-affinity streptavidin-biotin complex.Freitag S., le Trong I., Chilkoti A., Klumb L.A., Stayton P.S., Stenkamp R.E.J. Mol. Biol. 279:211-221(1998) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.