ELISA Recombinant Rat Apolipoprotein C-III(Apoc3)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P06759 Gene Names: Apoc3 Organism: Rattus norvegicus (Rat) AA Sequence: DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP Expression Region: 21-101aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 11 kDa Alternative Name(s): Apolipoprotein C3 Relevance: Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a mµLtifaceted role in triglyceride homeostasis. IntracellµLarly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; ExtracellµLar domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors. Reference: Linkage, evolution, and expression of the rat apolipoprotein A-I, C-III, and A-IV genes.Haddad I.A., Ordovas J.M., Fitzpatrick T., Karathanasis S.K.J. Biol. Chem. 261:13268-13277(1986) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.