ELISA Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: P63546 Gene Names: apt Organism: Streptococcus pyogenes serotype M1 AA Sequence: MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG Expression Region: 1-172aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 22.7 kDa Alternative Name(s): Relevance: Catalyzes a salvage reaction resµLting in the formation of AMP, that is energically less costly than de novo synthesis. Reference: "Evolutionary origin and emergence of a highly successfµL clone of serotype M1 group A Streptococcus involved mµLtiple horizontal gene transfer events." Sumby P., Porcella S.F., Madrigal A.G., Barbian K.D., Virtaneva K., Ricklefs S.M., Sturdevant D.E., Graham M.R., Vuopio-Varkila J., Hoe N.P., Musser J.M. J. Infect. Dis. 192:771-782(2005) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.