ELISA Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein(ACB1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P31787 Gene Names: ACB1 Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) AA Sequence: MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS Expression Region: 1-87aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 12.1 kDa Alternative Name(s): Short name:ACBP Relevance: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellµLar carrier of acyl-CoA esters. Reference: "Quantitative trait loci mapped to single-nucleotide resolution in yeast."Deutschbauer A.M., Davis R.W.Nat. Genet. 37:1333-1340(2005) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.