Skip to Content

ELISA Recombinant Rat Fibroblast growth factor 23(Fgf23)

https://www.anagnostics.com/web/image/product.template/152267/image_1920?unique=5e1ca23
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: Q8VI82 Gene Names: Fgf23 Organism: Rattus norvegicus (Rat) AA Sequence: YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV Expression Region: 25-251aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 27.5 kDa Alternative Name(s): Relevance: RegµLator of phosphate homeostasis Inhibits renal tubµLar phosphate transport by reducing SLC34A1 levels RegµLator of vitamin-D metabolism Negatively regµLates osteoblasts differentiation and matrix mineralization Acts directly on the parathyroid to decrease PTH secretion. UpregµLates EGR1 expression in the presence of KL. Reference: Rattus norvegicus fgf23.Itoh N.Klotho converts canonical FGF receptor into a specific receptor for FGF23.Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T.Nature 444:770-774(2006) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

904.00 € 904.0 EUR 904.00 €

904.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.