ELISA Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: CardiovascµLar Uniprot ID: P32301 Gene Names: Glp1r Organism: Rattus norvegicus (Rat) AA Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEEQLLSLY Expression Region: 22-145aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 16.3 kDa Alternative Name(s): Glpr Relevance: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellµLar cAMP levels. Plays a role in regµLating insµLin secretion in response to GLP-1 Reference: "Mutations to the third cytoplasmic domain of the glucagon-like peptide 1 (GLP-1) receptor can functionally uncouple GLP-1-stimµLated insµLin secretion in HIT-T15 cells." Salapatek A.M., MacDonald P.E., Gaisano H.Y., Wheeler M.B. Unknown Journal 13:1305-1317(1999) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.