ELISA Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Neuroscience Uniprot ID: P32301 Gene Names: Glp1r Organism: Rattus norvegicus (Rat) AA Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN Expression Region: 22-135aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 15.1 kDa Alternative Name(s): Relevance: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Reference: "Expression cloning of the pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1."Thorens B.Proc. Natl.Acad. Sci. U.S.A. 89:8641-8645(1992) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.