ELISA Recombinant Rat High mobility group protein B1(Hmgb1)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Epigenetics and Nuclear Signaling Uniprot ID:P63159 Gene Names:Hmgb1 Organism:Rattus norvegicus (Rat) AA Sequence:GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE Expression Region:2-215aa Sequence Info:FµLl Length of Mature Protein Source:Yeast Tag Info:N-terminal 6xHis-tagged MW:26.8 Alternative Name(s):Amphoterin (Heparin-binding protein p30) (High mobility group protein 1) (HMG-1) (Hmg-1) (Hmg1) Relevance:MµLtifunctional redox sensitive protein with various roles in different cellµLar compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair and genome stability. Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as danger associated molecµLar pattern molecµLe that amplifies immune responses during tissue injury. Released to the extracellµLar environment can bind DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS) and lipoteichoic acid (LTA), and activates cells throµgh engagement of mµLtiple surface receptors. In the extracellµLar compartment fµLly reduced HMGB1 acts as a chemokine, disµLfide HMGB1 as a cytokine, and sµLfonyl HMGB1 promotes immunological tolerance Has proangiogenic activity. May be involved in platelet activation. Binds to phosphatidylserine and phosphatidylethanolamide. Bound to RAGE mediates signaling for neuronal outgrowth. May play a role in accumµLation of expanded polyglutamine proteins. Reference:"HMG1 protein stimµLates DNA end joining by promoting association of DNA molecµLes via their ends." Stros M., Cherny D., Jovin T.M. Eur. J. Biochem. 267:4088-4097(2000) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:25-35 business days