ELISA Recombinant Rat 72KDA type IV collagenase(Mmp2)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P33436 Gene Names: Mmp2 Organism: Rattus norvegicus (Rat) AA Sequence: YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC Expression Region: 110-662aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 64.1 kDa Alternative Name(s): 72KDA gelatinaseGelatinase AMatrix metalloproteinase-2 ;MMP-2 Relevance: Ubiquitinous metalloproteinase that is involved in diverse functions such as rodeling of the vascµLature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading ExtracellµLar domain matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regµLating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascµLar tissues PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrin alpha-v/beta3 on the surface of blood vessels Reference: Homology cloning of rat 72KDA type IV collagenase cytokine and second-messenger inducibility in glomerµLar mesangial cells.Marti H.P., McNeil L., Davies M., Martin J., Lovett D.H.Biochem. J. 291:441-446(1993) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.