ELISA Recombinant Rat NADPH oxidase 4(Nox4),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: Q924V1 Gene Names: Nox4 Organism: Rattus norvegicus (Rat) AA Sequence: GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE Expression Region: 210-424aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-SUMO-tagged MW: 40.6 kDa Alternative Name(s): Kidney oxidase-1 ;KOX-1Kidney superoxide-producing NADPH oxidase Relevance: Constitutive NADPH oxidase which generates superoxide intracellµLarly upon formation of a complex with CYBA/p22phox. RegµLates signaling cascades probably throµgh phosphatases inhibition. May function as an oxygen sensor regµLating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regµLate insµLin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. Reference: Direct interaction of the novel Nox proteins with p22phox is required for the formation of a functionally active NADPH oxidase.Ambasta R.K., Kumar P., Griendling K.K., Schmidt H.H.H.W., Busse R., Brandes R.P.J. Biol. Chem. 279:45935-45941(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.