ELISA Recombinant Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P20259 Gene Names: N/A Organism: Pseudechis porphyriacus (Red-bellied black snake) AA Sequence: NLIQFSNMIKCAIPGSRPLFQYADYGCYCGPGGHGTPVDELDRCCKIHDDCYGEAGKKGCFPKLTLYSWKCTEKVPTCNAKSRCKDFVCACDAEAAKCFAKAPYIKENYNINTKTRC Expression Region: 1-117aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-sumostar-tagged MW: 29 kDa Alternative Name(s): Phosphatidylcholine 2-acylhydrolase Relevance: PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Reference: "Purification, sequencing and characterization of pseudexin phospholipases A2 from Pseudechis porphyriacus (Australian red-bellied black snake)." Schmidt J.J., Middlebrook J.L. Toxicon 27:805-818(1989) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.