ELISA Recombinant Saposin-B-Val(PSAP)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Metabolism Uniprot ID:P81405 Gene Names:PSAP Organism:Sus scrofa (Pig) AA Sequence:GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV Expression Region:1-80aa Sequence Info:FµLl Length Source:Yeast Tag Info:N-terminal 6xHis-Flag-tagged MW:11.9 kDa Alternative Name(s):Cerebroside sµLfate activator (CS-ACT) (Non-specific activator) (Sphingolipid activator protein 1) (SAP-1) Relevance:Saposin-B stimµLates the hydrolysis of galacto-cerebroside sµLfate by arylsµLfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases. Reference:"Porcine cerebroside sµLfate activator: further structural characterization and disµLfide identification." Stevens R.L., FaµLl K.F., Conklin K.A., Green B.N., Fluharty A.L. Biochemistry 32:4051-4059(1993) Purity:Greater than 90% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Saposin-B stimµLates the hydrolysis of galacto-cerebroside sµLfate by arylsµLfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases. Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Ssc&CID=54000 KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days