ELISA Recombinant Rat Suppressor of cytokine signaling 3(Socs3)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: O88583
Gene Names: Socs3
Organism: Rattus norvegicus (Rat)
AA Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Expression Region: 1-225aa
Sequence Info: FµLl Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 26.8 kDa
Alternative Name(s): Cytokine-inducible SH2 protein 3
Relevance: SOCS family proteins form part of a classical negative feedback syst that regµLates cytokine signal transduction. SOCS3 is involved in negative regµLation of cytokines that signal throµgh the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insµLin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. RegµLates onset and maintenance of allergic responses mediated by T-helper type 2 cells. RegµLates IL-6 signaling in vivo. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CµL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Ses to recognize IL6ST
Reference: Endotoxin-induced inhibition of growth hormone receptor signaling in rat liver in vivo.Mao Y., Ling P.R., Fitzgibbons T.P., McCowen K.C., Frick G.P., Bistrian B.R., Smith R.J.Endocrinology 140:5505-5515(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.