ELISA Recombinant Xenopus laevis Transforming growth factor beta-1(TGFB1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Signal Transduction Uniprot ID: P16176 Gene Names: TGFB1 Organism: Xenopus laevis (African clawed frog) AA Sequence: GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS Expression Region: 271-382aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 14.6 kDa Alternative Name(s): TGF-beta-5 Relevance: Important role in certain aspects of differentiation. Reference: "Identification of a novel transforming growth factor-beta (TGF-beta 5) mRNA in Xenopus laevis."Kondaiah P., Sands M.J., Smith J.M., Fields A., Roberts A.B., Sporn M.B., Melton D.A.J. Biol. Chem. 265:1089-1093(1990) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.