ELISA Recombinant Xenopus laevis Transforming growth factor beta-1(TGFB1)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Signal Transduction
Uniprot ID: P16176
Gene Names: TGFB1
Organism: Xenopus laevis (African clawed frog)
AA Sequence: GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS
Expression Region: 271-382aa
Sequence Info: FµLl Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 14.6 kDa
Alternative Name(s): TGF-beta-5
Relevance: Important role in certain aspects of differentiation.
Reference: "Identification of a novel transforming growth factor-beta (TGF-beta 5) mRNA in Xenopus laevis."Kondaiah P., Sands M.J., Smith J.M., Fields A., Roberts A.B., Sporn M.B., Melton D.A.J. Biol. Chem. 265:1089-1093(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.