ELISA Recombinant Sheep Tumor necrosis factor(TNF),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P23383 Gene Names: TNF Organism: Ovis aries (Sheep) AA Sequence: LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL Expression Region: 78-234aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 19.2 kDa Alternative Name(s): Cachectin;TNF-alphaTumor necrosis factor ligand superfamily member 2 ;TNF-a Relevance: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimµLation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimµLate cell proliferation and induce cell differentiation.The TNF intracellµLar domain (ICD) form induces IL12 production in dendritic cells. Reference: MolecµLar cloning, expression and characterization of ovine TNF alpha.Andrews A.E., Nash A.D., Barcham G.J., Brandon M.R.Immunol. Cell Biol. 69:273-283(1991) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.