ELISA Recombinant Toxoplasma gondii Profilin(PRF)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: Q58NA1 Gene Names: PRF Organism: Toxoplasma gondii AA Sequence: SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY Expression Region: 2-163aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 19.4 kDa Alternative Name(s): Relevance: Reference: A profilin-like protein from Toxoplasma gondii potently triggers dendritic cell IL-12 production throµgh TLR11.Yarovinsky F., Zhang D., Andersen J.F., Bannenberg G.L., Serhan C.N., Hayden M.S., Hieny S., Sutterwala F., Flavell R.A., Ghosh S., Sher A.Skillman K.M., Sibley D. Common inheritance of chromosome Ia associated with clonal expansion of Toxoplasma gondii.Khan A., Bohme U., Kelly K.A., Adlem E., Brooks K., Simmonds M., Mungall K., Quail M.A., Arrowsmith C., Chillingworth T., Churcher C., Harris D., Collins M., Fosker N., Fraser A., Hance Z., Jagels K., MoµLe S. , Murphy L., O'Neil S., Rajandream M.A., Saunders D., Seeger K., Whitehead S., Mayr T., Xuan X., Watanabe J., Suzuki Y., Wakaguri H., Sµgano S., Sµgimoto C., PaµLsen I., Mackey A.J., Roos D.S., Hall N., Berriman M., Barrell B., Sibley L.D., Ajioka J.W.Genome Res. 16:1119-1125(2006) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.