Skip to Content

ELISA Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin

https://www.anagnostics.com/web/image/product.template/157428/image_1920?unique=263afdf
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P85101 Gene Names: N/A Organism: Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica) AA Sequence: RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN Expression Region: 1-234aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 28.1 kDa Alternative Name(s): Relevance: Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticµLocyte lysate system with an IC50 of 0.17 nM. Reference: "Sequence determination of lychnin, a type 1 ribosome-inactivating protein from Lychnis chalcedonica seeds."Chambery A., de Donato A., Bolognesi A., Polito L., Stirpe F., Parente A.Biol. Chem. 387:1261-1266(2006) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,169.57 € 1169.57 EUR 1,169.57 €

1,169.57 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.