Skip to Content

ELISA Recombinant Triangle waterfern Cyanovirin-N homolog

https://www.anagnostics.com/web/image/product.template/160167/image_1920?unique=b3f4f0f
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P86326 Gene Names: N/A Organism: Ceratopteris richardii (Triangle waterfern) AA Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE Expression Region: 28-142aa Sequence Info: FµLl Length of Mature Protein Source: Yeast Tag Info: N-terminal 10xHis-tagged MW: 14.9 kDa Alternative Name(s): Relevance: Mannose-binding lectin Reference: "The evolutionarily conserved family of cyanovirin-N homologs: structures and carbohydrate specificity."Koharudin L.M.I., Viscomi A.R., Jee J.-G., Ottonello S., Gronenborn A.M.Structure 16:570-584(2008) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,169.57 € 1169.57 EUR 1,169.57 €

1,169.57 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.