ELISA Recombinant White-rot fungus Cellobiose dehydrogenase(CDH-1),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Microbiology Uniprot ID: Q01738 Gene Names: CDH-1 Organism: Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum) AA Sequence: QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG Expression Region: 19-208aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 22.3 kDa Alternative Name(s): Cellobiose-quinone oxidoreductase Relevance: Degrades both lignin and cellµLose. Oxidizes cellobiose to cellobionolactone. Reference: "Cellobiose dehydrogenase from Phanerochaete chrysosporium is encoded by two allelic variants."Li B., Nagalla S.R., Renganathan V.Appl. Environ. Microbiol. 63:796-799(1997) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.