ELISA Recombinant Toxoplasma gondii Dense granule protein 1(GRA1)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P13403
Gene Names: GRA1
Organism: Toxoplasma gondii
AA Sequence: AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE
Expression Region: 25-190aa
Sequence Info: FµLl Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 19.9 kDa
Alternative Name(s): Major antigen p24
Relevance:
Reference: MolecµLar characterization of a 23-kilodalton major antigen secreted by Toxoplasma gondii.Cesbron-Delauw M.-F., Guy B., Torpier G., Pierce R.J., Lenzen G., Cesbron J.Y., Charif H., Lepage P., Darcy F., Lecocq J.-P., Capron A.Proc. Natl. Acad. Sci. U.S.A. 86:7537-7541(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.