ELISA Recombinant Rabies virus Matrix protein(M)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P15200 Gene Names: M Organism: Rabies virus (strain PM) (RABV) AA Sequence: MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE Expression Region: 1-202aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 25.2 kDa Alternative Name(s): Phosphoprotein M2 Relevance: Plays a major role in assbly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bµLlet-shaped form. Inhibits viral transcription and stimµLates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons Reference: Sequence of the 3386 3' nucleotides of the genome of the AVO1 strain rabies virus structural similarities in the protein regions involved in transcription.Poch O., Tordo N., Keith G.Biochimie 70:1019-1029(1988) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.